A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids

Banana bunchy top virus (BBTV) is a six-component ssDNA virus (genus Babuvirus, family Nanoviridae) transmitted by aphids, infecting monocots (mainly species in the family Musaceae) and likely originating from South-East Asia where it is frequently associated with self-replicating alphasatellites. I...

Descripción completa

Detalles Bibliográficos
Autores principales: Guyot, V., Rajeswaran, R., Chu, H.C., Karthikeyan, C., Laboureau, N., Galzi, S., Mukwa, L., Krupovic, M., Kumar, P. Lava, Iskra-Caruana, M.L., Pooggin, M.
Formato: Journal Article
Lenguaje:Inglés
Publicado: 2022
Materias:
Acceso en línea:https://hdl.handle.net/10568/119608
_version_ 1855535195399127040
author Guyot, V.
Rajeswaran, R.
Chu, H.C.
Karthikeyan, C.
Laboureau, N.
Galzi, S.
Mukwa, L.
Krupovic, M.
Kumar, P. Lava
Iskra-Caruana, M.L.
Pooggin, M.
author_browse Chu, H.C.
Galzi, S.
Guyot, V.
Iskra-Caruana, M.L.
Karthikeyan, C.
Krupovic, M.
Kumar, P. Lava
Laboureau, N.
Mukwa, L.
Pooggin, M.
Rajeswaran, R.
author_facet Guyot, V.
Rajeswaran, R.
Chu, H.C.
Karthikeyan, C.
Laboureau, N.
Galzi, S.
Mukwa, L.
Krupovic, M.
Kumar, P. Lava
Iskra-Caruana, M.L.
Pooggin, M.
author_sort Guyot, V.
collection Repository of Agricultural Research Outputs (CGSpace)
description Banana bunchy top virus (BBTV) is a six-component ssDNA virus (genus Babuvirus, family Nanoviridae) transmitted by aphids, infecting monocots (mainly species in the family Musaceae) and likely originating from South-East Asia where it is frequently associated with self-replicating alphasatellites. Illumina sequencing analysis of banana aphids and leaf samples from Africa revealed an alphasatellite that should be classified in a new genus, phylogenetically related to alphasatellites of nanoviruses infecting dicots. Alphasatellite DNA was encapsidated by BBTV coat protein and accumulated at high levels in plants and aphids, thereby reducing helper virus loads, altering relative abundance (formula) of viral genome components and interfering with virus transmission by aphids. BBTV and alphasatellite clones infected dicot Nicotiana benthamiana, followed by recovery and symptomless persistence of alphasatellite, and BBTV replication protein (Rep), but not alphasatellite Rep, induced leaf chlorosis. Transcriptome sequencing revealed 21, 22 and 24 nucleotide small interfering (si)RNAs covering both strands of the entire viral genome, monodirectional Pol II transcription units of viral mRNAs and pervasive transcription of each component and alphasatellite in both directions, likely generating double-stranded precursors of viral siRNAs. Consistent with the latter hypothesis, viral DNA formulas with and without alphasatellite resembled viral siRNA formulas but not mRNA formulas. Alphasatellite decreased transcription efficiency of DNA-N encoding a putative aphid transmission factor and increased relative siRNA production rates from Rep- and movement protein-encoding components. Alphasatellite itself spawned the most abundant siRNAs and had the lowest mRNA transcription rate. Collectively, following African invasion, BBTV got associated with an alphasatellite likely originating from a dicot plant and interfering with BBTV replication and transmission. Molecular analysis of virus-infected banana plants revealed new features of viral DNA transcription and siRNA biogenesis, both affected by alphasatellite. Costs and benefits of alphasatellite association with helper viruses are discussed.
format Journal Article
id CGSpace119608
institution CGIAR Consortium
language Inglés
publishDate 2022
publishDateRange 2022
publishDateSort 2022
record_format dspace
spelling CGSpace1196082025-11-11T10:41:31Z A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids Guyot, V. Rajeswaran, R. Chu, H.C. Karthikeyan, C. Laboureau, N. Galzi, S. Mukwa, L. Krupovic, M. Kumar, P. Lava Iskra-Caruana, M.L. Pooggin, M. rna bananas viruses plant diseases dna aphididae Banana bunchy top virus (BBTV) is a six-component ssDNA virus (genus Babuvirus, family Nanoviridae) transmitted by aphids, infecting monocots (mainly species in the family Musaceae) and likely originating from South-East Asia where it is frequently associated with self-replicating alphasatellites. Illumina sequencing analysis of banana aphids and leaf samples from Africa revealed an alphasatellite that should be classified in a new genus, phylogenetically related to alphasatellites of nanoviruses infecting dicots. Alphasatellite DNA was encapsidated by BBTV coat protein and accumulated at high levels in plants and aphids, thereby reducing helper virus loads, altering relative abundance (formula) of viral genome components and interfering with virus transmission by aphids. BBTV and alphasatellite clones infected dicot Nicotiana benthamiana, followed by recovery and symptomless persistence of alphasatellite, and BBTV replication protein (Rep), but not alphasatellite Rep, induced leaf chlorosis. Transcriptome sequencing revealed 21, 22 and 24 nucleotide small interfering (si)RNAs covering both strands of the entire viral genome, monodirectional Pol II transcription units of viral mRNAs and pervasive transcription of each component and alphasatellite in both directions, likely generating double-stranded precursors of viral siRNAs. Consistent with the latter hypothesis, viral DNA formulas with and without alphasatellite resembled viral siRNA formulas but not mRNA formulas. Alphasatellite decreased transcription efficiency of DNA-N encoding a putative aphid transmission factor and increased relative siRNA production rates from Rep- and movement protein-encoding components. Alphasatellite itself spawned the most abundant siRNAs and had the lowest mRNA transcription rate. Collectively, following African invasion, BBTV got associated with an alphasatellite likely originating from a dicot plant and interfering with BBTV replication and transmission. Molecular analysis of virus-infected banana plants revealed new features of viral DNA transcription and siRNA biogenesis, both affected by alphasatellite. Costs and benefits of alphasatellite association with helper viruses are discussed. 2022 2022-05-20T15:14:31Z 2022-05-20T15:14:31Z Journal Article https://hdl.handle.net/10568/119608 en Open Access application/pdf Guyot, V., Rajeswaran, R., Chu, H.C., Karthikeyan, C., Laboureau, N., Galzi, S., ... & Pooggin, M. (2022). A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids. PLoS Pathogens, 18(4), 1-40.
spellingShingle rna
bananas
viruses
plant diseases
dna
aphididae
Guyot, V.
Rajeswaran, R.
Chu, H.C.
Karthikeyan, C.
Laboureau, N.
Galzi, S.
Mukwa, L.
Krupovic, M.
Kumar, P. Lava
Iskra-Caruana, M.L.
Pooggin, M.
A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids
title A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids
title_full A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids
title_fullStr A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids
title_full_unstemmed A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids
title_short A newly emerging alphasatellite affects banana bunchy top virus replication, transcription, siRNA production and transmission by aphids
title_sort newly emerging alphasatellite affects banana bunchy top virus replication transcription sirna production and transmission by aphids
topic rna
bananas
viruses
plant diseases
dna
aphididae
url https://hdl.handle.net/10568/119608
work_keys_str_mv AT guyotv anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT rajeswaranr anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT chuhc anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT karthikeyanc anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT laboureaun anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT galzis anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT mukwal anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT krupovicm anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT kumarplava anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT iskracaruanaml anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT poogginm anewlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT guyotv newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT rajeswaranr newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT chuhc newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT karthikeyanc newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT laboureaun newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT galzis newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT mukwal newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT krupovicm newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT kumarplava newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT iskracaruanaml newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids
AT poogginm newlyemergingalphasatelliteaffectsbananabunchytopvirusreplicationtranscriptionsirnaproductionandtransmissionbyaphids