Research-policy linkages: Empirical evidence from agroeconomic research in India

Policy-making processes in developing countries often continue to operate devoid of evidence. In this study, we explore the research-policy linkages between the agroeconomic research system (AERS) and the agricultural policy system (APS) in India. Specifically, we examine questions directed to the M...

Descripción completa

Detalles Bibliográficos
Autores principales: Balaji, S. J., Babu, Suresh Chandra, Pal, Suresh
Formato: Artículo preliminar
Lenguaje:Inglés
Publicado: International Food Policy Research Institute 2020
Materias:
Acceso en línea:https://hdl.handle.net/10568/143556
_version_ 1855527497159933952
author Balaji, S. J.
Babu, Suresh Chandra
Pal, Suresh
author_browse Babu, Suresh Chandra
Balaji, S. J.
Pal, Suresh
author_facet Balaji, S. J.
Babu, Suresh Chandra
Pal, Suresh
author_sort Balaji, S. J.
collection Repository of Agricultural Research Outputs (CGSpace)
description Policy-making processes in developing countries often continue to operate devoid of evidence. In this study, we explore the research-policy linkages between the agroeconomic research system (AERS) and the agricultural policy system (APS) in India. Specifically, we examine questions directed to the Ministry of Agriculture and Farmers’ Welfare in the two houses of the national parliament—the House of the People (Lok Sabha) and the Council of States (Rajya Sabha)—and filter them for key issues that confront the APS. In addition, using the list of research articles published in two major national agricultural economics journals, we examine the alignment of the AERS toward addressing pressing policy issues. We use 6,465 questions raised by elected representatives in the parliamentary houses and 377 research articles, both during the period 2014–2018. We use machine learning techniques for information retrieval because the required information is hidden as non-numerical text. Using tag clouds (lists of words by frequency), we identify key divergences between the concerns of the APS and the research focus of the AERS, and explore their linkages. To broaden our understanding, we employ latent Dirichlet allocation, a natural language processing technique that identifies crucial issues and automates their classification under appropriate clusters, to examine synergies between the research and policy systems. Results show remarkable alignment between the AERS and the APS, invalidating the two-communities hypothesis. We identify persistent issues in the policy domain that require the support of the research system, as well as potential areas for research system realignment.
format Artículo preliminar
id CGSpace143556
institution CGIAR Consortium
language Inglés
publishDate 2020
publishDateRange 2020
publishDateSort 2020
publisher International Food Policy Research Institute
publisherStr International Food Policy Research Institute
record_format dspace
spelling CGSpace1435562025-12-02T21:03:03Z Research-policy linkages: Empirical evidence from agroeconomic research in India Balaji, S. J. Babu, Suresh Chandra Pal, Suresh research policies policies agricultural research agricultural policies farmers machine learning capacity development agricultural economics Policy-making processes in developing countries often continue to operate devoid of evidence. In this study, we explore the research-policy linkages between the agroeconomic research system (AERS) and the agricultural policy system (APS) in India. Specifically, we examine questions directed to the Ministry of Agriculture and Farmers’ Welfare in the two houses of the national parliament—the House of the People (Lok Sabha) and the Council of States (Rajya Sabha)—and filter them for key issues that confront the APS. In addition, using the list of research articles published in two major national agricultural economics journals, we examine the alignment of the AERS toward addressing pressing policy issues. We use 6,465 questions raised by elected representatives in the parliamentary houses and 377 research articles, both during the period 2014–2018. We use machine learning techniques for information retrieval because the required information is hidden as non-numerical text. Using tag clouds (lists of words by frequency), we identify key divergences between the concerns of the APS and the research focus of the AERS, and explore their linkages. To broaden our understanding, we employ latent Dirichlet allocation, a natural language processing technique that identifies crucial issues and automates their classification under appropriate clusters, to examine synergies between the research and policy systems. Results show remarkable alignment between the AERS and the APS, invalidating the two-communities hypothesis. We identify persistent issues in the policy domain that require the support of the research system, as well as potential areas for research system realignment. 2020-11-01 2024-05-22T12:15:04Z 2024-05-22T12:15:04Z Working Paper https://hdl.handle.net/10568/143556 en Open Access application/pdf International Food Policy Research Institute Balaji, S. J.; Babu, Suresh Chandra; and Pal, Suresh. 2020. Research-policy linkages: Empirical evidence from agroeconomic research in India. IFPRI Discussion Paper 1970. Washington, DC: International Food Policy Research Institute (IFPRI). https://doi.org/10.2499/p15738coll2.134140.
spellingShingle research policies
policies
agricultural research
agricultural policies
farmers
machine learning
capacity development
agricultural economics
Balaji, S. J.
Babu, Suresh Chandra
Pal, Suresh
Research-policy linkages: Empirical evidence from agroeconomic research in India
title Research-policy linkages: Empirical evidence from agroeconomic research in India
title_full Research-policy linkages: Empirical evidence from agroeconomic research in India
title_fullStr Research-policy linkages: Empirical evidence from agroeconomic research in India
title_full_unstemmed Research-policy linkages: Empirical evidence from agroeconomic research in India
title_short Research-policy linkages: Empirical evidence from agroeconomic research in India
title_sort research policy linkages empirical evidence from agroeconomic research in india
topic research policies
policies
agricultural research
agricultural policies
farmers
machine learning
capacity development
agricultural economics
url https://hdl.handle.net/10568/143556
work_keys_str_mv AT balajisj researchpolicylinkagesempiricalevidencefromagroeconomicresearchinindia
AT babusureshchandra researchpolicylinkagesempiricalevidencefromagroeconomicresearchinindia
AT palsuresh researchpolicylinkagesempiricalevidencefromagroeconomicresearchinindia